PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00055255-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 278aa    MW: 31640.6 Da    PI: 9.0653
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00055255-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88.2e-162266147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg+ +++E+el+ +++++lG++ W++Ia +++ gRt++++k++w++ 
  PSME_00055255-RA 22 RGSISPDEEELIFRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTC 66
                      7888******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.051116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-10228IPR009057Homeodomain-like
SuperFamilySSF466893.51E-19372IPR009057Homeodomain-like
PROSITE profilePS5129425.2641771IPR017930Myb domain
SMARTSM007175.4E-152169IPR001005SANT/Myb domain
PfamPF002492.9E-142266IPR001005SANT/Myb domain
CDDcd001672.43E-112665No hitNo description
Gene3DG3DSA:1.10.10.603.1E-202967IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
LKRCGKSCRL RWTNYLRPGI KRGSISPDEE ELIFRLHRLL GNRWSLIAGR LPGRTDNEIK  60
NYWNTCLSKK LLLDESQPKR MSRSPSPKRN HVLIKTIPRR IITAVKHVGI LNANDYSNRL  120
SSDKALKLCT IQQNAKSTNL GCNLQVNDSE RSEFAMTDVT DQVRNSATCY MSSFVDQQSP  180
HFDNSAAHGA TLAGNLFDLP EALSPHCNLL SSPSFFWTES GLEQFGMRRA TSVGAETIAF  240
EDTSYDQSNS KNVNRFTLAD DRRMEEFYGN SQQVDWIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2037140108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1091361e-72BT109136.1 Picea glauca clone GQ03205_A18 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FJA21e-41TT2_ARATH; Transcription factor TT2
TrEMBLB8LMJ63e-78B8LMJ6_PICSI; Putative uncharacterized protein
STRINGAT5G35550.13e-39(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.18e-43MYB family protein